Protein Info for GFF1837 in Xanthobacter sp. DMC5

Annotation: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape ptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01133: undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase" amino acids 4 to 354 (351 residues), 263.5 bits, see alignment E=1.4e-82 PF03033: Glyco_transf_28" amino acids 5 to 141 (137 residues), 100.5 bits, see alignment E=8.7e-33 PF04101: Glyco_tran_28_C" amino acids 188 to 354 (167 residues), 129 bits, see alignment E=1.9e-41

Best Hits

Swiss-Prot: 60% identical to MURG_NITHX: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (murG) from Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)

KEGG orthology group: K02563, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC: 2.4.1.227] (inferred from 84% identity to xau:Xaut_1191)

Predicted SEED Role

"UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227)" in subsystem Peptidoglycan Biosynthesis (EC 2.4.1.227)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.227

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (375 amino acids)

>GFF1837 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape ptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (Xanthobacter sp. DMC5)
VTDLVLLAAGGTGGHLFPAEALAAVLTRQGFTVDLATDARAARYAGHFPARELHVLPADT
VRGRSPISLARTGFALASGFVSSLALLRRVKPVAVVGFGGYPTVPPLLAASFSGVPSIVH
EANGVMGRANRLLARRVTAIATGFPGVVDADPALKAKAVWTGNPLRPAAIAAAAAPYDPP
VPGGDLHVLVFGGSQGARVMSDVVPEAVERLGADLRARLVLVQQAREEDLDRVRDTYARL
GVRAQVQTFFDDLPARMARAHLVISRSGAGTVAELAALGRPSILVPLPHALDQDQAANAR
SLADVGAALVLRQVEFEPDRLALELNTFAAEPASLTRMADQARSQSVLDAAERLGGLVRH
LAGGGAVATFRGNSA