Protein Info for GFF1837 in Sphingobium sp. HT1-2

Annotation: Inner membrane transport protein YdhP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 60 (23 residues), see Phobius details amino acids 72 to 95 (24 residues), see Phobius details amino acids 97 to 98 (2 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 201 to 224 (24 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 268 to 288 (21 residues), see Phobius details amino acids 294 to 313 (20 residues), see Phobius details amino acids 331 to 351 (21 residues), see Phobius details amino acids 357 to 375 (19 residues), see Phobius details PF07690: MFS_1" amino acids 10 to 319 (310 residues), 131.1 bits, see alignment E=4.8e-42 PF00083: Sugar_tr" amino acids 42 to 184 (143 residues), 30.3 bits, see alignment E=2.2e-11

Best Hits

KEGG orthology group: K08156, MFS transporter, DHA1 family, arabinose polymer transporter (inferred from 79% identity to swi:Swit_0553)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>GFF1837 Inner membrane transport protein YdhP (Sphingobium sp. HT1-2)
MKINPPLLALAAGAFGIGVTEFAPMGLLPVIATDLGVSIPAAGLLISAYAIGVMLGAPLM
TLTTGRLPRRTLLIGLAAIFTVGNLIAALSTSYAMLLFARIITSLNHGAFFGVGSIVAAS
LVPPQRQAGAVAAMFMGLTIANVVGVPLATWAGEVMGWRAAFWGIAALGVLTIAALRLTL
PDMPAPTEGDARSELRVLMRGPVLAALGLTVVGASAMFTVFTYITPILRDQTHGSIGFVT
AMLVLYGVGLTIGNWLGGRFADRSVDRTLIVTLAALTAILIAFAFAMPFAGPTAVLIFLW
GIASFALVPPLQVRVMSAAADAPNLASSMNIGAFNLGNAIGAALGGAVIAAGLSLPFVAI
AGAVASSLGLIALLLSRRSGAPRAATA