Protein Info for GFF1829 in Variovorax sp. SCN45

Annotation: 4-hydroxybenzoyl-CoA thioesterase (EC 3.1.2.23)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13279: 4HBT_2
  • amino acids 16 to 137 (122 residues), 58.9 bits, E=7e-20
• PF03061: 4HBT
  • amino acids 25 to 108 (84 residues), 26.8 bits, E=5.3e-10

Best Hits

Swiss-Prot: 49% identical to 4HBT_PSEUC: 4-hydroxybenzoyl-CoA thioesterase from Pseudomonas sp. (strain CBS-3)

KEGG orthology group: K01075, 4-hydroxybenzoyl-CoA thioesterase [EC: 3.1.2.23] (inferred from 91% identity to vpe:Varpa_4528)

MetaCyc: 49% identical to 4-hydroxybenzoyl-CoA thioesterase monomer (Pseudomonas sp. CBS3)
4-hydroxybenzoyl-CoA thioesterase. [EC: 3.1.2.23]

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems

MetaCyc Pathways

• 4-hydroxybenzoate biosynthesis III (plants) (4/5 steps found)
• 4-chlorobenzoate degradation (2/4 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.23

Use Curated BLAST to search for 3.1.2.23

Protein Sequence (142 amino acids)

>GFF1829 4-hydroxybenzoyl-CoA thioesterase (EC 3.1.2.23) (Variovorax sp. SCN45)
MSNTSAIKEIVYTARVEFGDCDPAGIVWFPNFFRWIDAASRHFFAECGVPRWEETTETLG
VIGTPLVDTHTRFVKAASYGDTLQIAVRIKEWREKSFVQTYRVTRGEDLILECEEVRIFG
AKREGGGIRAVQIPPSIRVLCE