Protein Info for GFF1827 in Xanthobacter sp. DMC5

Annotation: Disulfide bond formation protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 45 to 63 (19 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details PF02600: DsbB" amino acids 12 to 96 (85 residues), 37.9 bits, see alignment E=1.2e-13

Best Hits

KEGG orthology group: None (inferred from 53% identity to rso:RS04712)

Predicted SEED Role

"PROBABLE TRANSMEMBRANE PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (197 amino acids)

>GFF1827 Disulfide bond formation protein B (Xanthobacter sp. DMC5)
MDTGLTLADRFRVLNALGLLAVSAVLIAAFFDQLVFNDLPCPLCLLQRAGFVCVAAGLAL
NVKFGPRPSHYAIMILSSLAGGAVSTRQTLLHIIPGEGAYGDAFFGLHFYAWALVLFAVC
VLGSAVLLLFDGQFERQSADAPLHRPLLGTAAIVLVLLLALANGVSTVLECGSGLCADNP
TSYQLIQDGTLNRLIGR