Protein Info for GFF1827 in Sphingobium sp. HT1-2

Annotation: Non-heme chloroperoxidase (EC 1.11.1.10)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF00561: Abhydrolase_1" amino acids 24 to 259 (236 residues), 108.4 bits, see alignment E=9.6e-35 PF12146: Hydrolase_4" amino acids 25 to 261 (237 residues), 76.4 bits, see alignment E=4.5e-25 PF12697: Abhydrolase_6" amino acids 26 to 261 (236 residues), 69.4 bits, see alignment E=1.4e-22 PF00326: Peptidase_S9" amino acids 152 to 277 (126 residues), 25 bits, see alignment E=2.5e-09

Best Hits

Swiss-Prot: 75% identical to PRXC_BURPY: Non-heme chloroperoxidase (cpo) from Burkholderia pyrrocinia

KEGG orthology group: None (inferred from 85% identity to npp:PP1Y_Mpl7373)

Predicted SEED Role

"Non-heme chloroperoxidase (EC 1.11.1.10)" (EC 1.11.1.10)

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.10

Use Curated BLAST to search for 1.11.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>GFF1827 Non-heme chloroperoxidase (EC 1.11.1.10) (Sphingobium sp. HT1-2)
MSFVTTDDGVDIFFKDWGPKDAQPIMFHHGWPLSSDDWDAQMLFFLSKGYRVVAHDRRGH
GRSAQVSEGHDMAHYAADAAAVARHLDLRNAIHIGHSTGGGEVAAYVARHGLPESRVAKA
VLVSSVPPIMLKTDRYPGGLPMDVFDGLRAGLAANRAQFFHDVAAGPFYGFNRDGADVKP
AVIDNWWRQGMMGSAKAHYEGIKAFSETDQTDDLTAITVPTLVLHGDDDQVVPYKNAGVL
QAQILPNATLKIYEGYSHGMLTVNSDVLNADILAFIQA