Protein Info for GFF1826 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 225 to 246 (22 residues), see Phobius details amino acids 257 to 277 (21 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details PF00892: EamA" amino acids 18 to 150 (133 residues), 80.1 bits, see alignment E=9.6e-27 amino acids 165 to 300 (136 residues), 60.4 bits, see alignment E=1.2e-20

Best Hits

KEGG orthology group: None (inferred from 78% identity to xau:Xaut_1200)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>GFF1826 hypothetical protein (Xanthobacter sp. DMC5)
MSATPVRPSRFALYDAPYVLLTLVALLWAINLVVGRYIAGHIPPITLAMVRWIGATLILL
PFAWKQIVRDMPIIRRSLPLLVLLSATGIASYNAMSYYGLQYTQAVNGLLVQSTAPLLVA
VWTFVLFREKLSLGQAAGVITSLVGVMVIISHGDLDTFLHLKPNIGDVVIIVALVIYALY
AAILRKRPPLGPLSFLATIMALGSLLLSPFALWEYLNGKVLPLDHVTFFTLAYVMTGPSL
VAYLFFNRGVELVGANAAAPFLHLLPVFGTALAIVFLGETMAWYHLAGYALVISGIALAT
LSARRRMAPH