Protein Info for GFF1822 in Sphingobium sp. HT1-2

Annotation: Possible hydrolase or acyltransferase RutD in novel pyrimidine catabolism pathway

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 TIGR03611: pyrimidine utilization protein D" amino acids 8 to 259 (252 residues), 298.8 bits, see alignment E=1.6e-93 PF00561: Abhydrolase_1" amino acids 18 to 132 (115 residues), 82.7 bits, see alignment E=5.1e-27 PF12146: Hydrolase_4" amino acids 21 to 122 (102 residues), 34 bits, see alignment E=3e-12 PF12697: Abhydrolase_6" amino acids 21 to 251 (231 residues), 51.7 bits, see alignment E=3e-17

Best Hits

Swiss-Prot: 44% identical to RUTD_SERP5: Putative aminoacrylate hydrolase RutD (rutD) from Serratia proteamaculans (strain 568)

KEGG orthology group: K09023, protein RutD (inferred from 44% identity to spe:Spro_1820)

Predicted SEED Role

"Possible hydrolase or acyltransferase RutD in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>GFF1822 Possible hydrolase or acyltransferase RutD in novel pyrimidine catabolism pathway (Sphingobium sp. HT1-2)
LAEAAGLYYEIHGRADAPPLILSSGLGGSASYWAPNIPALAEHFHVIAYDHRGTGRSDRT
LPETTSVEDMAGDVVVLMDALGIGSAHFIGHALGGAIGMELAIATSRLDSLIIINGWRTL
SPHTRRCFDTRLALLRHAGVEAFLRAQPLFLFPPDWIAAHDDALKAELAHHLATFPGAAT
MEQRIAAVQAYSPHLFDLTAVAKVLAIATRDDFLVPHASALDVATPIAWARTASFDWGGH
ACNVTDPDAFHRLVLPFLRS