Protein Info for GFF1820 in Sphingobium sp. HT1-2

Annotation: Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (EC 3.5.1.110)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 74% identical to RUTB_HALO1: Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB) from Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2)

KEGG orthology group: K09020, putative isochorismatase family protein RutB [EC: 3.-.-.-] (inferred from 74% identity to hoh:Hoch_3936)

MetaCyc: 66% identical to ureidoacrylate amidohydrolase (Escherichia coli K-12 substr. MG1655)
RXN-12896 [EC: 3.5.1.110]; 3.5.1.110 [EC: 3.5.1.110]

Predicted SEED Role

"Predicted amidohydrolase RutB in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

MetaCyc Pathways

uracil degradation III (5/5 steps found)
L-citrulline degradation (3/3 steps found)
L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
cyanate degradation (2/3 steps found)
allantoin degradation IV (anaerobic) (2/9 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.-.-.- or 3.5.1.110

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>GFF1820 Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (EC 3.5.1.110) (Sphingobium sp. HT1-2)
MTAALDHWVHLLNPAPVSEAIVDPAPSRSGPCVVLPARPEAIRLDAATTALIVVDMQNAY
ASKGGYVDEAGFDVSPAAGVIPRIAEVVEVARAAGMPVIFLQNGWDSGYAEAGTPLSPNW
HKSNALKTMRARPDLAGKFLARGGWDYELVEALAPHENDLRVHKPRYSAFFNSQLDSVLR
ARGIRTLVFTGIATNVCVESTLRDGFHLEYFGVLLEDAVHHLGPDFIREASLYNVEKFFG
WVSNVADFRTAVGQLPPKEI