Protein Info for GFF1817 in Variovorax sp. SCN45

Annotation: 5-hydroxyisourate hydrolase (EC 3.5.2.17)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 116 TIGR02962: hydroxyisourate hydrolase" amino acids 3 to 116 (114 residues), 123.7 bits, see alignment E=2.3e-40 PF00576: Transthyretin" amino acids 3 to 115 (113 residues), 122.4 bits, see alignment E=6.4e-40

Best Hits

Swiss-Prot: 55% identical to HIUH2_RHIME: 5-hydroxyisourate hydrolase 2 (RB1166) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K07127, 5-hydroxyisourate hydrolase [EC: 3.5.2.17] (inferred from 95% identity to vap:Vapar_3925)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (116 amino acids)

>GFF1817 5-hydroxyisourate hydrolase (EC 3.5.2.17) (Variovorax sp. SCN45)
MGLSTHVLDTMHGGPAAGMEVALYTTDGDAATLVKRFTLNSDGRGDGPLYDNNSLKVGTY
RLVFDVAGYFKARGVELPEPNFLNKVSLDFGVAHTDQHYHVPLLVSPWSYSTYRGS