Protein Info for GFF1817 in Sphingobium sp. HT1-2

Annotation: Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 89 to 106 (18 residues), see Phobius details amino acids 112 to 129 (18 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details PF02518: HATPase_c" amino acids 331 to 430 (100 residues), 59.1 bits, see alignment E=5.7e-20

Best Hits

KEGG orthology group: K15011, two-component system, sensor histidine kinase RegB [EC: 2.7.13.3] (inferred from 82% identity to sch:Sphch_1105)

Predicted SEED Role

"Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>GFF1817 Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-) (Sphingobium sp. HT1-2)
MSETQAVRRRWLPSQWPADAAGRKNMALLIQLRWIAIAGQLVTILIVQFLMGVRLPLAPM
LLVAAVAVLVNAASFAALRPRTDITRAELSVSLLFDVLLLTAQLYLSGGATNPFVSLYLL
QVALGVLLLDRASAWGITAVSALCAGLLALDYRPLDLSDRLAGRLFDLHIIGTWICFTMI
AVLLVLFITRINRNLQAREAYLASMRQHAAEEEHIVRMGLLASGAAHELGTPLAQLAVVL
GDWRRMPEITEHPALVEEVGEMQSAVLRCKAIVTGILLSSGEARGEAPAVTNVRDFIEGI
AAEWRRANPGMPLRCDFGPHDYPRIIADPVIRQAVGNLLDNAREAGATYIDLLVGRDSAS
LNIAVRDNGSGFSQAMLEDFGKPYRSSKGKEGHGLGLFLVVNVVRKLGGSVSASNGADGG
ALILLRLPLDTVALEEESDSEDDS