Protein Info for GFF1816 in Sphingobium sp. HT1-2

Annotation: Cytochrome oxidase biogenesis protein Surf1, facilitates heme A insertion

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details PF02104: SURF1" amino acids 26 to 222 (197 residues), 188.7 bits, see alignment E=8.5e-60

Best Hits

Swiss-Prot: 32% identical to SURF1_MONBE: SURF1-like protein (18583) from Monosiga brevicollis

KEGG orthology group: K14998, surfeit locus 1 family protein (inferred from 73% identity to sch:Sphch_1104)

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Surf1, facilitates heme A insertion" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>GFF1816 Cytochrome oxidase biogenesis protein Surf1, facilitates heme A insertion (Sphingobium sp. HT1-2)
VTSAKIGGRRRRSPGFTIGLTLIALILFSGLCALGSWQVYRLAWKRDLIARVDARIHAAP
VPAPRSITSDDEYRRVTASGHFLHDKAVLTQAVTVRGPGFWVMTPLVTDAGFTLMVNRGF
VPQDNRTRYSRPQGKVQVIGLLRLTEPKGGFLRSNDPAAGRWYSRDVAAIAAAQHVAPPV
ADYFVDAGANCAPDTAPVGGLTVVRFPNNHLQYAITWFILAAMVAGAYIFLMRRDPEDST
E