Protein Info for GFF1815 in Xanthobacter sp. DMC5

Annotation: Manganese transport system membrane protein MntB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 55 to 80 (26 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details PF00950: ABC-3" amino acids 8 to 262 (255 residues), 259.2 bits, see alignment E=4.5e-81 PF01032: FecCD" amino acids 55 to 259 (205 residues), 35.4 bits, see alignment E=6.6e-13

Best Hits

Swiss-Prot: 54% identical to Y359_HAEIN: Probable iron transport system membrane protein HI_0359 (HI_0359) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K11606, manganese/iron transport system permease protein (inferred from 89% identity to xau:Xaut_1204)

Predicted SEED Role

"Manganese ABC transporter, inner membrane permease protein SitD" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>GFF1815 Manganese transport system membrane protein MntB (Xanthobacter sp. DMC5)
MSLFAPFQFDFMQTALVIAALVAVPMALLSCFLVLKGWSLMGDAVSHAVLPGVVLAYIAG
LPLAFGAFVAGMICALGTGYLKANSRVKEDTVMGVVFSGMFGLGLVLYTKIQTDVHLDHI
LFGDMLGVSWGDIAESALIAGLVTLVLLAKWRDLLLNAFDPAQAKAVGLHTGLLHYGLLV
MLSLTIVAALKAVGIILAVALLIAPGAIAFLVTKRFGWMLTASVLVAVSCSLAGVYLSFF
LDSAPAPTIVLLMTGVFIAAFVGVRLKARRVEAASN