Protein Info for GFF1814 in Xanthobacter sp. DMC5

Annotation: Manganese transport system membrane protein MntB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 63 to 86 (24 residues), see Phobius details amino acids 106 to 131 (26 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details amino acids 223 to 240 (18 residues), see Phobius details amino acids 246 to 263 (18 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details PF00950: ABC-3" amino acids 59 to 314 (256 residues), 274.3 bits, see alignment E=1.1e-85 PF01032: FecCD" amino acids 115 to 310 (196 residues), 28.4 bits, see alignment E=9e-11

Best Hits

Swiss-Prot: 69% identical to YFEC_YERPE: Chelated iron transport system membrane protein YfeC (yfeC) from Yersinia pestis

KEGG orthology group: K11605, manganese/iron transport system permease protein (inferred from 92% identity to xau:Xaut_1205)

Predicted SEED Role

"Manganese ABC transporter, inner membrane permease protein SitC" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>GFF1814 Manganese transport system membrane protein MntB (Xanthobacter sp. DMC5)
MARLVPAIHVDRPGALFRTARHRPDVDARHKAGHTGTVVSRIAPPRGRLNMTLLLEPFSY
SYMVNAMWVSALVGAVCAFLSAFLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFSVGAFF
AGALAAGAMLFLQERTKLKEDAVIGLIFTSFFGLGLFMVSLSPTSVNVQTIVLGNILAIS
PADTLQLAIIGFVSLALLLVFWKDLMVTFFDESHARSIGLKPTALKVMFFTLLAASTVAA
LQTVGAFLVIAMVVTPGATAYLLTDRFPRLIALSVAIGATTCFVGAYASYFLDGATGGII
VVLQTLIFLLAFVFAPKHGVLAARRQAAAALKEGAA