Protein Info for GFF1814 in Sphingobium sp. HT1-2

Annotation: Cytochrome O ubiquinol oxidase subunit III (EC 1.10.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 139 to 164 (26 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details TIGR02842: cytochrome o ubiquinol oxidase, subunit III" amino acids 27 to 206 (180 residues), 265.1 bits, see alignment E=2.1e-83 PF00510: COX3" amino acids 28 to 204 (177 residues), 53.1 bits, see alignment E=2.3e-18

Best Hits

Swiss-Prot: 59% identical to CYOC_ECOL6: Cytochrome bo(3) ubiquinol oxidase subunit 3 (cyoC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02299, cytochrome o ubiquinol oxidase subunit III [EC: 1.10.3.-] (inferred from 96% identity to sch:Sphch_1102)

MetaCyc: 59% identical to cytochrome bo3 subunit 3 (Escherichia coli K-12 substr. MG1655)
RXN-21817 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit III (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>GFF1814 Cytochrome O ubiquinol oxidase subunit III (EC 1.10.3.-) (Sphingobium sp. HT1-2)
MSSATATTEPRAYHLPEEPHLHEGHSTMLGFWMYLMSDCLIFAILFATYAVLGGSFAGGP
GPKDLFDLPLIALNTAMLLFSSITYGFAMLAMEKNRISATQGWLFVTLLFGGAFLFIELY
EFSHLIHEGAGPWRSAFLSAFFTLVGTHGLHVTFGSIWLITLMVQVAKKGLIPANKRRLM
CLSMFWHFLDVIWIGVFTFVYLMGVLR