Protein Info for GFF1813 in Xanthobacter sp. DMC5

Annotation: Manganese transport system ATP-binding protein MntB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF00005: ABC_tran" amino acids 33 to 180 (148 residues), 105.5 bits, see alignment E=3.5e-34

Best Hits

Swiss-Prot: 66% identical to YFEB_YERPE: Chelated iron transport system membrane protein YfeB (yfeB) from Yersinia pestis

KEGG orthology group: K11607, manganese/iron transport system ATP-binding protein (inferred from 88% identity to xau:Xaut_1206)

Predicted SEED Role

"Manganese ABC transporter, ATP-binding protein SitB" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>GFF1813 Manganese transport system ATP-binding protein MntB (Xanthobacter sp. DMC5)
MNAPLTRQALAEAGAGILVEHVTVTYRNGHTALRDASFAIPIGTITALVGVNGSGKSTLF
KTIMGFLKAARGEVRILGLSVPEALKRNVVAYVPQAEEVDWTFPVLVEDVVMMGRYGHMN
LLRIPGAADRAAVEAALSRVNMLDFRKRQIGELSGGQRKRVFLARALAQDARVILLDEPF
TGVDVKTEDAIIALLRALRDEGRVMLVSTHNLGSVPEFCDRTVLVKGTVLAYGLTSEVFT
QANLEKAFGGVLRHFVLDESHSATPGTLGVLTDDERPLVLYKDRPAQSGTAGSSEGIG