Protein Info for GFF1813 in Variovorax sp. SCN45

Annotation: Acetylornithine deacetylase-like protein Acry_1162

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 TIGR01910: peptidase, ArgE/DapE family" amino acids 19 to 398 (380 residues), 219 bits, see alignment E=5.7e-69 PF01546: Peptidase_M20" amino acids 90 to 404 (315 residues), 84.6 bits, see alignment E=9.5e-28 PF07687: M20_dimer" amino acids 192 to 302 (111 residues), 70.4 bits, see alignment E=1.2e-23

Best Hits

KEGG orthology group: None (inferred from 95% identity to vap:Vapar_3929)

Predicted SEED Role

"Acetylornithine deacetylase (EC 3.5.1.16)" in subsystem Arginine Biosynthesis extended (EC 3.5.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.16

Use Curated BLAST to search for 3.5.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>GFF1813 Acetylornithine deacetylase-like protein Acry_1162 (Variovorax sp. SCN45)
MTDYAKLDAWIDAHFDEEVQFLQQLVQVPTDTPPGNNAPHAERTAELLKDFGLDAEKHAV
PTQEVKDYGLETITNLIVRRKYGNDGLTVALNAHGDVVPPGEGWTHDPYGGEIVDGSLYG
RAAAVSKSDFASFTFALRALEAVAKPAKGSVELHFTYDEEFGGILGPGWLLDKGLTKPDL
MIAAGFSYEVVTAHNGCLQMEVTVHGKMAHAAVPATGIDALQGATKILNALYAQNTLYQQ
VTSKVEGITHPYLNVGRIEGGTNTNVVPGKVVFKLDRRMIPEENPVEVEAAIRKVIADAA
AESAGITVEIKRLLLANSMKPLAGNKPLVDAIQKHGHDVFGEPIKAMGTPLYTDVRLYVE
AGIPGVIYGAGPRTVLESHAKRSDERVVLEDLRRATKVIARTLSDLLA