Protein Info for GFF1812 in Sphingobium sp. HT1-2

Annotation: Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 45 to 69 (25 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details TIGR01433: ubiquinol oxidase, subunit II" amino acids 21 to 251 (231 residues), 331.1 bits, see alignment E=1.5e-103 PF00116: COX2" amino acids 162 to 231 (70 residues), 23.8 bits, see alignment E=3.6e-09 PF06481: COX_ARM" amino acids 251 to 296 (46 residues), 61.2 bits, see alignment 7e-21

Best Hits

KEGG orthology group: K02297, cytochrome o ubiquinol oxidase subunit II [EC: 1.10.3.-] (inferred from 87% identity to sch:Sphch_1100)

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (371 amino acids)

>GFF1812 Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-) (Sphingobium sp. HT1-2)
MSHPLSPNWSRLLRWSSAILAAPLAGCNWVVMNPSGDIAVQQRDLILISTALMLLIVIPV
MALVVYFAWRYRAANKAVEKEYDPDWDHSTKLELLIWSAPLLIIICLGALTWVSTHKLDP
YRPLDRIDAQTAIDPKVKPLVVQVVALDWKWLFIYPEQGIATVNEMALPTNVPVRFDITA
STVMNSFYIPELAGQIYAMPGMKTQLHAVANKPVTGTGFSANYSGAGFTHMRFGYKALDQ
AGFDAWVAKVKASNASLDRNVYLNLAKPSEKAPVAYFSTADAKLFDAVVNLCPKPGQRCM
GELMHINQMGGAGKESAKETEGLQYDFPNSHVIDQTDRNEGRETAPDAPGAEKAPADHSS
HSGADAHAQHR