Protein Info for GFF1811 in Variovorax sp. SCN45

Annotation: diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 138 to 167 (30 residues), see Phobius details amino acids 172 to 181 (10 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 243 to 401 (159 residues), 118.7 bits, see alignment E=1e-38 PF00990: GGDEF" amino acids 246 to 398 (153 residues), 123.2 bits, see alignment E=4.5e-40

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (449 amino acids)

>GFF1811 diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) (Variovorax sp. SCN45)
MNFSAPPPTLTASVDGELLSRMVRADQLVMVRRSVLAAIPINIVLSFTATLVALNSGRAF
EGLCWLMLSLAVNGVRSYVCRWPFAPSRGVLLDSSVATSPKGRPVEWHLRLSAALAGVSG
LVWALIPLLCSGYSSPQAVFYLTVVCGICAGSVTYGTAFAFVPISFITPALLSVAGCLVY
SGGFDNVSLAAMVLLYLGALVRSALHSERAFREGSRLRNEATAMTEQLRQVHALSLEATQ
QLSFRASHDSLTGLLNREGFTEAATLHIVASRGQQHCLLLLDLDGFKAVNDAFGHKVGDR
VLQDVAGWLQRELTDLRAVLSRWGGDEFAVLYSLQGARQAPAAIAQALIRSISFATAHYG
GHLGVSIGISVSGDADIADMISFADEALYEAKRTGRNRYQFFDAPLNLRLGTRRDVERDL
LNAIEARAIGVWYQPIMGCDVTATSRPRK