Protein Info for GFF1809 in Sphingobium sp. HT1-2

Annotation: Ammonium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 63 to 87 (25 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 215 to 239 (25 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details amino acids 331 to 353 (23 residues), see Phobius details amino acids 370 to 397 (28 residues), see Phobius details PF00909: Ammonium_transp" amino acids 33 to 418 (386 residues), 225.4 bits, see alignment E=5.5e-71

Best Hits

KEGG orthology group: K03320, ammonium transporter, Amt family (inferred from 61% identity to sjp:SJA_C1-20950)

Predicted SEED Role

"Ammonium transporter" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>GFF1809 Ammonium transporter (Sphingobium sp. HT1-2)
MRPALALPVLAALLLAQPAAAQVAAPDSGDTGWMIACALLLLLAALPGLMLRHAGLANVR
HGLAAMAQTLVAGATILLGWGLAGYSLAYAPGSEWLGGGSNLLLANLAPLRDGLTVPESA
FVLFQMGFAVLAGAIAVGAIAGRARLGWVAAFAPLWLLLVFAPIVHWMWGGGWLAQLGAM
DFAGGLVVHVLAGFSALALALVAGRPRDAQGGGHAHILAIAGGALFWVGYAGAVGGWALG
ATDDAATAILNLFFAACAASLGWALVDRLLGAHASATGLLSGAIAGLAAISASAALVGTG
GAMLIGLAAAIIARIGAGFASAWIDDPAHIFAVHGLGGATGALLLPLFVLPLLGGVGFDA
GITATASLLAQAIGLVVIALWALVGTAIAALIVSILVPLRATPQAEADGPDAVEHGQQGW
DFR