Protein Info for GFF1809 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Probable transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 47 to 71 (25 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 112 to 129 (18 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details amino acids 267 to 289 (23 residues), see Phobius details amino acids 296 to 314 (19 residues), see Phobius details amino acids 341 to 359 (19 residues), see Phobius details PF04892: VanZ" amino acids 22 to 129 (108 residues), 44.7 bits, see alignment E=1e-15

Best Hits

KEGG orthology group: None (inferred from 57% identity to rfr:Rfer_3803)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>GFF1809 Probable transmembrane protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
LKTRSSAWPLALLFAGVVVYASLYPFTGWRVQGVSPLAFLWAPLPQYWTGFDIASNLLGY
APLGFLLSVAMLRSGWGRWSWWLGFGVPALLSLAVETLQNYLPMRVPSNVDFVLNSAGAA
LGAVGAWLLERLGALRHWSQFRANWFEPSAHGGLVLLALWPFALLYPVSVPFGLGQVWDR
LEAGLVLLLEDTPFLTWVPVRLEAPDPLSPLAEAFCISLCLLSPLLMGFSEMRSVLRRAL
FVLMFFLGAAGAAGLSAALTYGPTHAWAWVSPQATMGLVIAFLLGLALLGLSRRLCMVVM
LLTLAVSLTLLNLAPDSPYFAQSLEVWEQGRFIRFHGISQWLGWVWPFAALIFGLRVVAR
APAAAERPTKIPP