Protein Info for GFF1803 in Xanthobacter sp. DMC5

Annotation: 5-hydroxyisourate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 116 TIGR02962: hydroxyisourate hydrolase" amino acids 2 to 116 (115 residues), 118 bits, see alignment E=1.3e-38 PF00576: Transthyretin" amino acids 4 to 115 (112 residues), 113.7 bits, see alignment E=3.5e-37

Best Hits

Swiss-Prot: 58% identical to HIUH_BRUME: 5-hydroxyisourate hydrolase (BMEI1429) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: K07127, 5-hydroxyisourate hydrolase [EC: 3.5.2.17] (inferred from 82% identity to xau:Xaut_3291)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.17

Use Curated BLAST to search for 3.5.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (116 amino acids)

>GFF1803 5-hydroxyisourate hydrolase (Xanthobacter sp. DMC5)
MGRLSTHVLDTVSGGPAADVAVELYRLTADGGRTLVTTRRTNSDGRTDAPLLAGDDFIPG
TYELVFHIGAHFRASGAPVADPPFLDVVPLRVTLIEGHYHVPLLCSPWSYSTYRGS