Protein Info for PS417_09155 in Pseudomonas simiae WCS417

Annotation: biopolymer transporter ExbD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details PF02472: ExbD" amino acids 8 to 134 (127 residues), 110.8 bits, see alignment E=2.4e-36

Best Hits

KEGG orthology group: K03559, biopolymer transport protein ExbD (inferred from 93% identity to psb:Psyr_0874)

Predicted SEED Role

"Biopolymer transport protein ExbD/TolR" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U1S3 at UniProt or InterPro

Protein Sequence (135 amino acids)

>PS417_09155 biopolymer transporter ExbD (Pseudomonas simiae WCS417)
MRTWDEPKKRKAHIELIPMIDVMMFLLVFFVLVSLNVIPALGMKTQLPSASSSQQLKPQN
KFILTLGLEGQLQLDGKDLTVDALVPALKAAEKPDTKSTIIVNSDKGVEVSRLVEVMDTL
RLGGFTSVSIATRKS