Protein Info for GFF180 in Sphingobium sp. HT1-2

Annotation: SSU rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase (EC 2.1.1.182)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 130 to 147 (18 residues), see Phobius details PF00398: RrnaAD" amino acids 22 to 275 (254 residues), 150.8 bits, see alignment E=2.1e-48 TIGR00755: ribosomal RNA small subunit methyltransferase A" amino acids 22 to 276 (255 residues), 218.6 bits, see alignment E=4.4e-69

Best Hits

Swiss-Prot: 70% identical to RSMA_ZYMMO: Ribosomal RNA small subunit methyltransferase A (rsmA) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K02528, 16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase [EC: 2.1.1.182] (inferred from 88% identity to sjp:SJA_C1-25560)

Predicted SEED Role

"SSU rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase (EC 2.1.1.182)" (EC 2.1.1.182)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.182

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>GFF180 SSU rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase (EC 2.1.1.182) (Sphingobium sp. HT1-2)
MPADARPTLPPLRDVIAAHGLQASKALGQNFLLDEQLLDRIAAIPGSIQDQPAFEVGPGP
GGLTRAILRAGGKLVAVERDRRCLPALAELELAFPGQLRVISGDAMEIDAHAEAGDGAHI
IANLPYNVGTALLVGWLSALWAPLPWWSSLTLMFQMEVAERIVAKPGTDHYGRLAVLAQW
RSDARIAMKVHRSAFTPPPKVMSAVVHITPKPAPEGVQLKILERLTAAAFGQRRKMLRQS
LKSVPGALDALEVIGIDPQRRAETVSVEEFVTLARQLGQATTGA