Protein Info for PS417_09150 in Pseudomonas simiae WCS417

Annotation: energy transducer TonB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF03544: TonB_C" amino acids 160 to 239 (80 residues), 25.2 bits, see alignment E=9.2e-10

Best Hits

KEGG orthology group: K03832, periplasmic protein TonB (inferred from 73% identity to psb:Psyr_0875)

Predicted SEED Role

"Ferric siderophore transport system, periplasmic binding protein TonB" in subsystem Campylobacter Iron Metabolism or Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U9K9 at UniProt or InterPro

Protein Sequence (242 amino acids)

>PS417_09150 energy transducer TonB (Pseudomonas simiae WCS417)
MYVLFRARQLLGSVPALIALVLIAVGIQSQTLKVEPVYDESAVELALVEPEPEVIPEPVV
EQAPPPPVIEDEEAEPAPPPPPPKPLPKPKHEPKPKPVPKPVVAQPTPAPAPPPVTAKPA
PAAVAQVAPTPAPPAPPKVDGQALEGGYLKGLRNELDTYKQYPTGRQASLERPTGEVVVW
LLVDRQGRVLDSGLQTQASSMLLNRAATNSLRRIKQVKPFPEQAFGGRNEQRFTATFNYS
VQ