Protein Info for PS417_09135 in Pseudomonas simiae WCS417

Annotation: phospholipase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13091: PLDc_2" amino acids 57 to 189 (133 residues), 80.4 bits, see alignment E=1.6e-26 amino acids 239 to 383 (145 residues), 44.7 bits, see alignment E=1.9e-15 PF00614: PLDc" amino acids 136 to 161 (26 residues), 23 bits, see alignment (E = 9.5e-09) PF13918: PLDc_3" amino acids 217 to 309 (93 residues), 30.8 bits, see alignment E=3.4e-11

Best Hits

KEGG orthology group: None (inferred from 74% identity to psb:Psyr_0878)

Predicted SEED Role

"Phosphatidylserine/phosphatidylglycerophosphate/cardiolipi n synthases and related enzymes"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UCZ0 at UniProt or InterPro

Protein Sequence (405 amino acids)

>PS417_09135 phospholipase (Pseudomonas simiae WCS417)
MSVSLKLRIAGLAGLLMSPLVQADFSIPGFELVHTVPVDTALGTDDLRQPGPVWSELFDG
AKSSIDIGQFYAVDHPGSVMDRVIERLEAAGKRGVKIRFLLEEKGIKLSEASTLERLRAI
PNLTFRVLPYARVSGGIIHAKYLVVDGKQAFVGSQNFDWRSLEHIHETGLRITDPTVVSQ
VQAIFEQDWKAQQALTDNQPVPLPVTRNAPPRTGNYLVASPQRYNPPGVGDSQLELPRLL
NEAKHEVRVQLLDYAPLSYGPDKTRPYYAVIDNAVRAAAARGVSIKLMVSNWNTDALELP
YLKSLAVLPNVQVKIVTLPQAKQGFIPYARVIHSKTMEIDGQVAWIGTSNWLGGYLDNSR
NLEVVMRSEAMAKRVGELHAQLWDGPYARALNVTEEYPEPHPGQH