Protein Info for GFF1793 in Xanthobacter sp. DMC5

Annotation: Aklanonic acid methyltransferase DauC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF13489: Methyltransf_23" amino acids 41 to 151 (111 residues), 42.2 bits, see alignment E=2.2e-14 PF13649: Methyltransf_25" amino acids 47 to 140 (94 residues), 67 bits, see alignment E=5.9e-22 PF13847: Methyltransf_31" amino acids 48 to 146 (99 residues), 47.5 bits, see alignment E=5.2e-16 PF08242: Methyltransf_12" amino acids 48 to 141 (94 residues), 47.3 bits, see alignment E=8.9e-16 PF08241: Methyltransf_11" amino acids 48 to 144 (97 residues), 83.1 bits, see alignment E=5.6e-27 PF01209: Ubie_methyltran" amino acids 64 to 144 (81 residues), 58.8 bits, see alignment E=1.6e-19

Best Hits

Swiss-Prot: 43% identical to PMTA_RHOSH: Phosphatidylethanolamine N-methyltransferase (pmtA) from Rhodobacter sphaeroides

KEGG orthology group: K00551, phosphatidylethanolamine N-methyltransferase [EC: 2.1.1.17] (inferred from 90% identity to xau:Xaut_0403)

MetaCyc: 42% identical to phosphatidyl-N-dimethylethanolamine N-methyltransferase [multifunctional] (Bradyrhizobium diazoefficiens USDA 110)
Phosphatidyl-N-methylethanolamine N-methyltransferase. [EC: 2.1.1.71]; 2.1.1.71 [EC: 2.1.1.71]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.17

Use Curated BLAST to search for 2.1.1.17 or 2.1.1.71

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>GFF1793 Aklanonic acid methyltransferase DauC (Xanthobacter sp. DMC5)
MAVQYDLEGQKKAYAKWAPIYDKVYVKLLADAQRKTSAAAAACGPDILEVGVGTGLVLPY
YPAGCRVTGIDLSFHMLQKAVEKKVERGLKQVGLLCAMDACKLGFADHSFDAVTVPFVIT
LVPDPEGALDEMYRVLRPGGEIVIASKLGADEGATMHIEAALAPLVKKVGWSIAFKASRL
RNWAAKYPDMEVVSIAPVFPVGFFKMVRIKKKAA