Protein Info for GFF1787 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Permeases of the major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 37 to 59 (23 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 272 to 289 (18 residues), see Phobius details amino acids 305 to 323 (19 residues), see Phobius details amino acids 326 to 352 (27 residues), see Phobius details amino acids 365 to 385 (21 residues), see Phobius details amino acids 392 to 411 (20 residues), see Phobius details PF07690: MFS_1" amino acids 41 to 262 (222 residues), 104.1 bits, see alignment E=7.8e-34 amino acids 272 to 408 (137 residues), 40.6 bits, see alignment E=1.6e-14 PF00083: Sugar_tr" amino acids 72 to 214 (143 residues), 37.1 bits, see alignment E=1.9e-13

Best Hits

Swiss-Prot: 91% identical to YNFM_ECOLI: Inner membrane transport protein YnfM (ynfM) from Escherichia coli (strain K12)

KEGG orthology group: K08224, MFS transporter, YNFM family, putative membrane transport protein (inferred from 99% identity to sea:SeAg_B1686)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>GFF1787 Permeases of the major facilitator superfamily (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VSRTTILDDATASDIDEQRHSQPVQFIKRGTAPFMRVTLALFSAGLATFALLYCVQPILP
VLSQEFGVSPASSSVSLSISTAMLAIGLLFTGPLSDAIGRKPVMVTALLLASCCTLLSTM
MTSWHGILIMRALIGLSLSGVAAVGMTYLSEEIHPSFVAFSMGLYISGNSIGGMSGRLLS
GVMTDFFNWRIALAAIGCFALASALMFWKILPASQHFRPTSLRPKTLFINFRLHWRDRGL
PLLFAEGFLLMGAFVTLFNYIGYRLMLSPWELSQAVVGLLSVAYLTGTWSSPKAGAMTSR
YGRGPVMLFSTAVMLGGLLLTLFTSLWLIFAGMLLFSAGFFAAHSVASSWIGPRARRAKG
QASSLYLFSYYLGSSIAGTLGGVFWHSYGWNGVGGFIALMLVLAILVGTRLHHRLHA