Protein Info for PS417_09080 in Pseudomonas simiae WCS417

Annotation: 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF12697: Abhydrolase_6" amino acids 26 to 261 (236 residues), 63.4 bits, see alignment E=1e-20 PF00561: Abhydrolase_1" amino acids 31 to 126 (96 residues), 70.8 bits, see alignment E=2.9e-23 PF12146: Hydrolase_4" amino acids 44 to 249 (206 residues), 36.3 bits, see alignment E=7.5e-13 PF03096: Ndr" amino acids 60 to 266 (207 residues), 31.1 bits, see alignment E=2.1e-11

Best Hits

KEGG orthology group: None (inferred from 92% identity to pfs:PFLU1856)

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.24

Use Curated BLAST to search for 3.1.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UFG4 at UniProt or InterPro

Protein Sequence (270 amino acids)

>PS417_09080 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase (Pseudomonas simiae WCS417)
MPVAVIDGQPLHYVDQGTGPVVLLGSSYLWDADMWSPQIEALSQQYRVIVPELWGHGESA
SLPAQTRSLDDLARQALTLIDQLDIAQINLVGLSVGGMWGARLALRAPERINSLVLMDTY
LGAEPEATRQYYFSLFKMIEDAGAIPEPLLDVVAPIFFRPGIDRESALYQDFRKQLQGYS
KERLLQSIVPLGRLIFSREDILEQLPRLDADTTLVMCGEQDKPRPPAESEEMAGLIGCSL
ILIPEAGHISARENPDFVNEALLTFLANNA