Protein Info for GFF1781 in Variovorax sp. SCN45

Annotation: Two-component transcriptional response regulator, LuxR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF00072: Response_reg" amino acids 4 to 113 (110 residues), 84.9 bits, see alignment E=4.4e-28

Best Hits

Swiss-Prot: 48% identical to RSSB_SERMA: Swarming motility regulation protein RssB (rssB) from Serratia marcescens

KEGG orthology group: None (inferred from 76% identity to del:DelCs14_2840)

MetaCyc: 36% identical to DNA-binding transcriptional dual regulator CpxR (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Two-component system response regulator QseB" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>GFF1781 Two-component transcriptional response regulator, LuxR family (Variovorax sp. SCN45)
MNLLLVEDDLDLGNGVRIALANQGMDVVWVRRLDDALRTLDGGTFDMVLLDLGLPDGDGL
DLLFRLRRDRQILPVLVLSARDALNDRLRSLDDGADDYLVKPFALAELLSRVRALARRSY
GFNDETIRMRGLALHEPTRGVIVDGEPVELSRCEFDLLALLLKRTGRVVTRRVMEEQVLP
GGQANGSNSLEVHISNLRRKIGQGYIRTVRGIGYVIDVQSLVRSTTK