Protein Info for GFF1781 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: TRAP-type C4-dicarboxylate transport system, large permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 6 to 33 (28 residues), see Phobius details amino acids 54 to 80 (27 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 133 to 159 (27 residues), see Phobius details amino acids 167 to 192 (26 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details amino acids 306 to 329 (24 residues), see Phobius details amino acids 337 to 387 (51 residues), see Phobius details amino acids 400 to 421 (22 residues), see Phobius details PF06808: DctM" amino acids 6 to 417 (412 residues), 380.7 bits, see alignment E=4.4e-118 TIGR00786: TRAP transporter, DctM subunit" amino acids 16 to 422 (407 residues), 422.9 bits, see alignment E=5.9e-131

Best Hits

Swiss-Prot: 37% identical to Y4ML_SINFN: Uncharacterized protein y4mL (NGR_a02470) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 86% identity to aaa:Acav_3313)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>GFF1781 TRAP-type C4-dicarboxylate transport system, large permease component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MVITLFVAAVVLMLIGVPVAFSLAIAAALAVALGGQYPQIIVFKEMFTGVDSFPLMAVPF
FILAAEIMSGGALTLVLLRFASQFVGHLRGGLGYANVLSLTIFSGISGSALADAAGPGSM
MVRMMDKAGYDRAYAAALTASTAIVGPIIPPSIIMIIYALQDEHVSVGALFIAGFIPGLL
IAAAMSWVNWWVCRRRDFRSDAPRPTGREMLMNTIKAVPALFLVVIILVGIRFGVFTPTE
ASVVAVFYALVCGKWVYGTLKWSALPGIAARSAMLTASVLFVVAASSAFAWVLTIEGVPQ
DLAQAIIGWDLSPVTFLIAVNILLLLFGIFMEPLPGVTILVPILAPIAAALGIDPIHFAM
VVIVNLTLGMITPPVGGLLFVTSVATKVPLMALTRELPPFLWAHLVVLVLLTFVPAISTW
LPHALGF