Protein Info for GFF1780 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 108 to 129 (22 residues), see Phobius details PF03918: CcmH" amino acids 12 to 153 (142 residues), 181.7 bits, see alignment E=2.4e-58

Best Hits

Swiss-Prot: 59% identical to CCMH_RHIME: Cytochrome c-type biogenesis protein CcmH (ccmH) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02200, cytochrome c-type biogenesis protein CcmH (inferred from 76% identity to xau:Xaut_1658)

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmL" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (164 amino acids)

>GFF1780 hypothetical protein (Xanthobacter sp. DMC5)
MAENPRAFLASLLLLLALGSPAFAVQPDEVLGDPVMESRARTISAELRCMVCQNQSIDDS
DAPLAKDLRIIVRERLKAGDSDSQVLDFMVARYGEFVLLRPRMSWRNALLWGAPILVLLL
GGLGAILALRRRSAAPPAPRLSAAEEARLKALLAESDGAGPTKP