Protein Info for GFF1779 in Xanthobacter sp. DMC5

Annotation: Cytochrome c-type biogenesis protein CcmF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 662 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 62 (24 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 249 to 265 (17 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details amino acids 351 to 373 (23 residues), see Phobius details amino acids 391 to 413 (23 residues), see Phobius details amino acids 425 to 442 (18 residues), see Phobius details amino acids 448 to 468 (21 residues), see Phobius details amino acids 493 to 511 (19 residues), see Phobius details amino acids 618 to 638 (21 residues), see Phobius details TIGR00353: cytochrome c-type biogenesis protein CcmF" amino acids 53 to 643 (591 residues), 611.2 bits, see alignment E=1.2e-187 PF01578: Cytochrom_C_asm" amino acids 89 to 295 (207 residues), 173.1 bits, see alignment E=6.4e-55 PF16327: CcmF_C" amino acids 315 to 640 (326 residues), 368.8 bits, see alignment E=2.6e-114

Best Hits

Swiss-Prot: 65% identical to CCMF_RHIME: Cytochrome c-type biogenesis protein CycK (cycK) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02198, cytochrome c-type biogenesis protein CcmF (inferred from 89% identity to xau:Xaut_1657)

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmF" in subsystem Biogenesis of c-type cytochromes or Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (662 amino acids)

>GFF1779 Cytochrome c-type biogenesis protein CcmF (Xanthobacter sp. DMC5)
MIAEIGQYALALAFALALAQVILPAWGAARGDAVLMGSAGPIALALFGFVAFAFGALVQL
YVTSDFTVVNVVENSHSQMPLVYRVTSTWGNHEGSMLLWVFVLAIFGALVVVFGANLPDR
LKALVLSVQGAVAAAFLSFILFTSNPFARIVPPPAEGRSLNPILQDPGLAIHPPLLYLGY
VGLSISFSFAIAALIEGRIDAAWARWVRPWTLAAWVFLTLGIAVGSYWAYYELGWGGWWF
WDPVENASLMPWLAATALLHSAVVMEKRDALKVWTILLAILAFSLSLVGTFLVRSGVLTS
VHAFATDPARGVFILGILTFFIAGGLALFAFRASELKQGGLFAPISREGALVFNNLFLTA
ATAAVLVGTLYPLALEAFTGAKITVGPPYFNLVFGGLMLPLVFAMPFGPLLAWKRGDILG
AAQRLMLAAGLAIVAAVVTAAATTGGPVLAPLAVGLAAFIMLGALTDLAERAGLGRVGAK
VALARLAGVPRSAYGTAIAHFGVGVCLLGIVCETSWSLEKIAAVKLGDTITIGSRTLTLD
RLENRTGPNFRARTAVFSIRDGGVPDGTIEASRRTFAARQMATTEAGLRTFGFSQLYVSM
AEEAADGHVSVRATFKPFVTLIWLGAVVMALGGVLSLADRRLRVGAPRPAAKKQRQAVAP
AE