Protein Info for PS417_09050 in Pseudomonas simiae WCS417
Annotation: transcriptional regulator
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 49% identical to VIRG_AGRFC: Regulatory protein VirG (virG) from Agrobacterium fabrum (strain C58 / ATCC 33970)
KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 98% identity to pfs:PFLU1850)Predicted SEED Role
"DNA-binding response regulator GltR, controls specific porins for the entry of glucose"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7TZV0 at UniProt or InterPro
Protein Sequence (254 amino acids)
>PS417_09050 transcriptional regulator (Pseudomonas simiae WCS417) MQTPSVSLNDEQKGAVIADDTRWNTRALIVDDDVPIRELLIDYLARFGILATGVTDGTAM RQAMQAETFDVVVLDLMLPGEDGLSLCRWLRAESDIPILMLTARCEPTDRIIGLELGADD YMSKPFEPRELVARIQTILRRVRDDRTEQRANIRFDNWRLNSVLRQLVADNGLVVPLSNA EFRLLWVFIERPRRVLSREQLLDAARGRSIEAFDRSIDLLVSRLRQKLGDDPKAPHLIKT VRGEGYLFDARDIG