Protein Info for GFF1778 in Xanthobacter sp. DMC5

Annotation: Cytochrome c-type biogenesis protein CcmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF03100: CcmE" amino acids 33 to 127 (95 residues), 120.4 bits, see alignment E=1.8e-39

Best Hits

Swiss-Prot: 87% identical to CCME_XANP2: Cytochrome c-type biogenesis protein CcmE (ccmE) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K02197, cytochrome c-type biogenesis protein CcmE (inferred from 87% identity to xau:Xaut_1656)

MetaCyc: 46% identical to periplasmic heme chaperone (Escherichia coli K-12 substr. MG1655)
RXN-21407

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmE, heme chaperone" in subsystem Biogenesis of c-type cytochromes

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (159 amino acids)

>GFF1778 Cytochrome c-type biogenesis protein CcmE (Xanthobacter sp. DMC5)
MTRKQRRLILIGAGLGVLALAAGLILSALNDTIVFFRTPTEVAQKQVTPGARLRLGGLVE
TGSVTKAGTLTTFSITDGNATVKVAYQGILPDLFREGQGVVAEGALQPDGQFKADSVLAK
HDEKYMPREVADALKQQGHWKDGAPAPGAASPSTRQPGS