Protein Info for PS417_09045 in Pseudomonas simiae WCS417

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 62 to 85 (24 residues), see Phobius details PF00672: HAMP" amino acids 85 to 135 (51 residues), 35.2 bits, see alignment 1.9e-12 PF00512: HisKA" amino acids 140 to 183 (44 residues), 29.2 bits, see alignment 1.1e-10 PF02518: HATPase_c" amino acids 237 to 342 (106 residues), 89.1 bits, see alignment E=4.1e-29

Best Hits

KEGG orthology group: None (inferred from 92% identity to pfs:PFLU1849)

Predicted SEED Role

"Sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U4B0 at UniProt or InterPro

Protein Sequence (343 amino acids)

>PS417_09045 histidine kinase (Pseudomonas simiae WCS417)
MRNGFNTLFGRLFGVLLVAIILAHVLAFSWFRYYGPPPPPQETFVEQPDGTMKPLPKHKR
PWFGGPVVPLTFQFISLIIAAWYGAKLLSRPIQRLSEAAERLSLDLDSPPLDESGPREAQ
QAASTFNLMQRRIREQVSQRARMLGAVSHDLRTPLSRLKLRLEQIDDTKLQGQMRQDLDD
MIGMLDATLSYLHEQRTSEARHWLDVQALVESMSENAQDQGADVQFAGTCAPLQVQPMAL
RSCLNNLIDNALRYAGTARIELTDSREALVIRVIDHGPGIAADKREAVFEPFYRLEGSRN
RNSGGVGLGMTISKEAAERLGGRLDLEETPGGGLTAVMWLPRV