Protein Info for GFF1774 in Xanthobacter sp. DMC5

Annotation: 2-haloacrylate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 114 to 131 (18 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details PF08240: ADH_N" amino acids 26 to 110 (85 residues), 61.1 bits, see alignment E=1.7e-20 PF00107: ADH_zinc_N" amino acids 151 to 268 (118 residues), 88 bits, see alignment E=8e-29 PF13602: ADH_zinc_N_2" amino acids 184 to 322 (139 residues), 60 bits, see alignment E=7.1e-20

Best Hits

KEGG orthology group: K00344, NADPH2:quinone reductase [EC: 1.6.5.5] (inferred from 83% identity to xau:Xaut_0406)

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>GFF1774 2-haloacrylate reductase (Xanthobacter sp. DMC5)
MKAVVCARHGAPETLEIRDLPQPVPGPGEVLVKVAAIGLNFFDTLIIRDLYQVKPELPFS
PGAEYAGHVAALGEGVTGFAVGDRVCGYQTYGAARAYVAAPAQFLAKVPDDLDLVKAAGL
IVTYGTALYALRDRGELKAGERLAVLGASGGVGLAAVELGRMLGARIIACASSPDKVRFA
LEHGADEGFDYASGDLKAALKAFGGEKGLDLVYDPVGGDMAEQALRALGSLGRFLVVGFA
AGEIPKIPLNLLLVKNCDMRGVAFGTHARANPGWLRDAVAELMGYAGDGRISAHVDKTFP
LEHCAEALGEISGRRVKGKVVLTIAD