Protein Info for GFF1774 in Variovorax sp. SCN45

Annotation: Leucine-responsive regulatory protein, regulator for leucine (or lrp) regulon and high-affinity branched-chain amino acid transport system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 PF13412: HTH_24" amino acids 4 to 51 (48 residues), 71.6 bits, see alignment E=6.3e-24 PF13404: HTH_AsnC-type" amino acids 4 to 45 (42 residues), 65.9 bits, see alignment E=4.5e-22 PF01037: AsnC_trans_reg" amino acids 68 to 148 (81 residues), 79 bits, see alignment E=4e-26

Best Hits

Swiss-Prot: 51% identical to LRP_KLEPN: Leucine-responsive regulatory protein (lrp) from Klebsiella pneumoniae

KEGG orthology group: K03719, Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein (inferred from 97% identity to vpe:Varpa_4595)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (155 amino acids)

>GFF1774 Leucine-responsive regulatory protein, regulator for leucine (or lrp) regulon and high-affinity branched-chain amino acid transport system (Variovorax sp. SCN45)
MPELDRIDRRILDVLQRQGRISMTELAEHIGLSASPCAERVKRMERDGVITGYHARVSPE
ALGKTLLVFVEIKLSAKSGDVFDKVKQELLHMPEVLECHLVSGSFDYLVKARLSGMSEYR
HLLGDILKKLPVAAESHSYVVMEEIKETLTLAVDR