Protein Info for GFF1770 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: TorCAD operon transcriptional regulatory protein TorR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 PF00072: Response_reg" amino acids 17 to 125 (109 residues), 94.1 bits, see alignment E=6.3e-31 PF00486: Trans_reg_C" amino acids 165 to 237 (73 residues), 59.6 bits, see alignment E=2.6e-20

Best Hits

Swiss-Prot: 82% identical to TORR_ECOLI: TorCAD operon transcriptional regulatory protein TorR (torR) from Escherichia coli (strain K12)

KEGG orthology group: K07772, two-component system, OmpR family, torCAD operon response regulator TorR (inferred from 100% identity to sea:SeAg_B4052)

Predicted SEED Role

"TorCAD operon transcriptional regulatory protein TorR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>GFF1770 TorCAD operon transcriptional regulatory protein TorR (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNRYEQKETARRMSHHIVIVEDEPVTQARLQAYFEQEGYRVSVTDSGAGLRDIMEHEHVS
LILLDINLPDENGLMLTRALRERSTVGIILVTGRCDQIDRIVGLEMGADDYVTKPLELRE
LVVRVKNLLWRIDLARPTPQNASENCYMFSGYCLNVMNHTLEHNGEAIKLTRAEYELLLA
FVTNPGKVLHRERLLRMLSARRVETPDLRTIDVLVRRLRHKITPELLVTQHGEGYFLASE
VY