Protein Info for GFF1768 in Sphingobium sp. HT1-2

Annotation: Gene Transfer Agent FAD/FMN-containing dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF09931: Phage_phiJL001_Gp84_N" amino acids 8 to 157 (150 residues), 159.2 bits, see alignment E=9.2e-51 TIGR02218: phage conserved hypothetical protein BR0599" amino acids 16 to 268 (253 residues), 202.8 bits, see alignment E=4.1e-64 PF09356: Phage_BR0599" amino acids 184 to 262 (79 residues), 87.8 bits, see alignment E=4.9e-29

Best Hits

KEGG orthology group: None (inferred from 77% identity to sch:Sphch_0213)

Predicted SEED Role

"FAD/FMN-containing dehydrogenases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>GFF1768 Gene Transfer Agent FAD/FMN-containing dehydrogenase (Sphingobium sp. HT1-2)
MSGGLEEVLCTLAFCWRLERRDGVAIGLTSHDRDLEIDGLRYRAAPGMTPSAIRSSIGLE
GSDSDVAGALVADAINEADLMAGRWDGAALELRLTQWEAPGALWRLLARGTIGAVARKGG
TFSAELVGAAAAMLAEPVAPSTSPDCRATLGDRQCRVAMAGRRQIVAVTGVADMVVDAAG
LEAGIYAYGMIRWLTGANAGIVQAVVDNDEGALRLADPPPFGVEAGTLALLTQGCDRQLA
SCAARFGNALNFRGEPYLPGTDLLTRYPGG