Protein Info for GFF1760 in Xanthobacter sp. DMC5

Annotation: Glucans biosynthesis glucosyltransferase H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 transmembrane" amino acids 38 to 58 (21 residues), see Phobius details amino acids 70 to 96 (27 residues), see Phobius details amino acids 396 to 420 (25 residues), see Phobius details amino acids 426 to 445 (20 residues), see Phobius details amino acids 452 to 472 (21 residues), see Phobius details amino acids 478 to 501 (24 residues), see Phobius details amino acids 522 to 544 (23 residues), see Phobius details amino acids 549 to 569 (21 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 126 to 305 (180 residues), 27.2 bits, see alignment E=5.2e-10 PF13632: Glyco_trans_2_3" amino acids 223 to 416 (194 residues), 52.8 bits, see alignment E=7.2e-18

Best Hits

KEGG orthology group: K03669, membrane glycosyltransferase [EC: 2.4.1.-] (inferred from 77% identity to xau:Xaut_2317)

Predicted SEED Role

"Glucans biosynthesis glucosyltransferase H (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (610 amino acids)

>GFF1760 Glucans biosynthesis glucosyltransferase H (Xanthobacter sp. DMC5)
MSSRSGPLSTLPEKHAPASATLTPALIQPLSTLRRRRLFMLVANVATVALVLAGMVALGA
HDGFSVVDGLLLVCALAITPWNAIGFWNAAVGLYLLHGRRRGVEAAAPFLAPPLPEGPIT
ARTAILLTVRNEDPSRALARLKAVKADLDLSGHGSAFDFHVLSDTSRPETAAAEEALVAA
WRAQEGPSRIFYRRRADNAGFKAGNIRAFCTDAGDRYDFMLPLDADSLMGADTILSMVRL
MAAYPRLGILQSLVVGLPSQSAFGRIFQFGMRHGMRSYTLGASWWAGDCGPFWGHNAVIR
VAPFRDACHLPELPGGPPFGGPVLSHDQVEAVLMRRAGYEVRVLPVESESYEENPPAATD
FVGRDLRWCLGNLQYLRLLTVPGLAASLQPMSRFQLVWAILMFVTVPAHPTLLALLPLAA
AEAGPAYPTGLALALYGGMMAMALLPKLAGVADVLLTVGGVARYGGALRFAGSVAAELVF
SFLLSAITAMAVTLEMVRLLLGRVRASWRAQARDGHGVDFAHAARAFWPQTVFGLAVLVA
LLAVQPVLALWAAPVLAGYVLAIPFTMATADPRLGRLCVRLGLCAVPEEFRPSRVQRLLA
GESFEARRAA