Protein Info for GFF1760 in Variovorax sp. SCN45

Annotation: Probable transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 48 to 70 (23 residues), see Phobius details amino acids 83 to 111 (29 residues), see Phobius details amino acids 131 to 153 (23 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 213 to 236 (24 residues), see Phobius details amino acids 248 to 265 (18 residues), see Phobius details amino acids 276 to 294 (19 residues), see Phobius details amino acids 300 to 322 (23 residues), see Phobius details amino acids 342 to 360 (19 residues), see Phobius details amino acids 366 to 385 (20 residues), see Phobius details PF07690: MFS_1" amino acids 17 to 325 (309 residues), 64.4 bits, see alignment E=4.5e-22

Best Hits

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>GFF1760 Probable transmembrane protein (Variovorax sp. SCN45)
VRLAARSRRALASVVAAQFLSSLADNALLIVAIDLLMQRHAPGWMTPALRLFFYLSYVLL
AAFAGAAADAAPKGRVLMATNLVKLCGCGLLLWHVQPLLAYTLVGLGAAAYSPAKYGILP
ELLPQDALVGANGWVEATTVLSILFGVALGSTLVGSKQALMAIGAVYLLAAACTLAIPHS
PARNRAALAHPGVLLRDFSHSLALLWRDPDARISLAVTSLFWAASATLQFLVLRFAAERL
GLTLSQGALLQIAVALGMAMGALGASRWFPLPRALRALPLGIVLGAVVLLMTLVTHLVVA
AVLLVVIGAFAGLLLVPMNALLQSRGLLRMNPGQSIAVQNFNESLASLAMLGVYGALIYF
DAPLLPTLAGFGGFLVLAMGGITVWSRRLGPARAALAAQNV