Protein Info for GFF1755 in Variovorax sp. SCN45

Annotation: diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 272 to 294 (23 residues), see Phobius details PF00672: HAMP" amino acids 285 to 337 (53 residues), 41.1 bits, see alignment 1.8e-14 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 342 to 508 (167 residues), 152.1 bits, see alignment E=5.8e-49 PF00990: GGDEF" amino acids 346 to 503 (158 residues), 172.1 bits, see alignment E=8.2e-55

Best Hits

KEGG orthology group: None (inferred from 54% identity to azo:azo2326)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (512 amino acids)

>GFF1755 diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) (Variovorax sp. SCN45)
MGLLMAILGTAASYIQLTRFLREDLTRSVAVQQTALADYVARDVDNYLGERLSFLERLAA
TLPPELLTQPGRLRPWLEERSALSALFPLGLMVADATGKRLDGAGQLATEGSEFEAARDG
QPALGRAQAASSGHSILPMAVPVRDAAGRVAAVLLGTADLSADGLLDHLQRGRVGQDGGI
LVVSPRDRIFVASTDLTMSLTPTPPEGVNPLHDRAMAGFRGNGTTRNAKGIEEISAIASV
PNSGWFVVARLPVAQALAPVGRMQTFILQQRAPAVAMVLIVIGLIMTWLLRPLLRAADQA
DRMTRGELALTPLRVVRNDEIGHLTQAFNRLLAKLHDNQEALARLAHHDTLTGLPNRKLL
DDRLQQALVRARRHSHRVAVLYLDLDGFKTLNDTLGHEAGDQALREIAHRLQALVRQTDT
VARIGGDEFVLLAADFEDPAEQSALALARRCIEAIAQPLQVAQSKTVIGASIGIALGNGG
ETPQDLLAAADKAMYRAKQNGRGSYVVAAQNV