Protein Info for GFF1753 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Uncharacterized glutathione S-transferase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 PF02798: GST_N" amino acids 2 to 73 (72 residues), 40 bits, see alignment E=1e-13 PF13417: GST_N_3" amino acids 6 to 78 (73 residues), 34 bits, see alignment E=7.3e-12 PF13409: GST_N_2" amino acids 12 to 75 (64 residues), 35.5 bits, see alignment E=3.2e-12 PF00043: GST_C" amino acids 117 to 193 (77 residues), 32.4 bits, see alignment E=2.3e-11 PF13410: GST_C_2" amino acids 124 to 187 (64 residues), 31.9 bits, see alignment E=2.9e-11

Best Hits

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 68% identity to pol:Bpro_4241)

Predicted SEED Role

"Uncharacterized glutathione S-transferase-like protein" in subsystem Glutathione: Non-redox reactions

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>GFF1753 Uncharacterized glutathione S-transferase-like protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLQLWGRLSSINVRKVVLCAQVLGLELPRTDAGLAHGIVDTPDYRRRNPNGLVPLLQDGD
FTLWESNAIVRYLCARENRLYPTDLRQRFDAERWMDWQQTTLNPAGSPGFKQWFRTPAEQ
RNAQVIAQSVAATEPLFAMLDEHLSHQAFMAGDALTMADIPIACEVHRWWGLPQPRPAWP
HLERWYAGWLARPASRGVLDLPLS