Protein Info for GFF1752 in Sphingobium sp. HT1-2

Annotation: Two-component system sensor histidine kinase/response regulator hybrid

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 658 PF00989: PAS" amino acids 17 to 123 (107 residues), 56.8 bits, see alignment E=8.6e-19 amino acids 144 to 253 (110 residues), 53.8 bits, see alignment E=7.4e-18 TIGR00229: PAS domain S-box protein" amino acids 17 to 139 (123 residues), 78.9 bits, see alignment E=1.8e-26 amino acids 140 to 267 (128 residues), 90.6 bits, see alignment E=4.4e-30 PF13426: PAS_9" amino acids 29 to 131 (103 residues), 47.1 bits, see alignment E=1e-15 amino acids 157 to 259 (103 residues), 47.8 bits, see alignment E=5.9e-16 PF08448: PAS_4" amino acids 29 to 134 (106 residues), 38.9 bits, see alignment E=3.7e-13 amino acids 157 to 262 (106 residues), 38.7 bits, see alignment E=4.1e-13 PF08447: PAS_3" amino acids 40 to 125 (86 residues), 26.7 bits, see alignment E=2.1e-09 amino acids 168 to 252 (85 residues), 26.5 bits, see alignment E=2.5e-09 PF13188: PAS_8" amino acids 144 to 197 (54 residues), 15.7 bits, see alignment 4.7e-06 PF00512: HisKA" amino acids 284 to 347 (64 residues), 31 bits, see alignment E=8.7e-11 PF02518: HATPase_c" amino acids 390 to 508 (119 residues), 66.6 bits, see alignment E=1e-21 PF00072: Response_reg" amino acids 533 to 615 (83 residues), 67.9 bits, see alignment E=3.5e-22

Best Hits

KEGG orthology group: None (inferred from 60% identity to cak:Caul_3668)

Predicted SEED Role

"Two-component hybrid sensor and regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (658 amino acids)

>GFF1752 Two-component system sensor histidine kinase/response regulator hybrid (Sphingobium sp. HT1-2)
MSGAEMGTTETGQPVNRFELLVQSVTDYAIFMLDPAGFVVSWNSGAQRIKGYSAEEIIGQ
HFSAFYTEGDRAAHVPAAVLRTAEVEGRFEAEGWRLRKDGTRFWANVVIDPIRDPAGHLL
GFAKVTRDLTERRAAQEELRRSEERFRLLVQSVTDYAIYMIDPVGTITSWNSGAERFKGY
SAEEIMGQNFARFYSEEDRMAGLPSRALDTAQREGRFEAEGWRIRKDGTRFWASVVIDPI
RDPAGELLGFAKITRDLTERRQAAQALEQAREAIFQSQKMDAIGKLTGGVAHDFNNLLAV
IVGSLDLARQRLAAGADISRYLDNAMTAADRGATLTQRMLAFARKQELKLEQVDCIGLIH
GMADLLKTTIGSSVAIETRFPLSLRPAHADPAQLELALINLAVNARDAMPDGGRLLIEGS
EITLALGDQPDLAAGSFIRLTVTDEGEGMDEATLARAREPFFTTKGVGKGTGLGLSMIHG
FTQQCGGAMTIASQPGKGTSVSIWLPVALTDASNERTAIPCEPDDLETEPLVILAVDDDD
LVLTNTAGMLETMGHTVFQAGSGREALHMLEQGRIDLVVTDHAMPGMTGAQLADAIEQTY
PDLPVLIITGYAELPADASRRLRLDKPFRQAELAMMVHRIRHDSALRRLVPIGTDSHP