Protein Info for GFF1751 in Xanthobacter sp. DMC5

Annotation: Dimethyl sulfoxide reductase DmsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 706 PF04879: Molybdop_Fe4S4" amino acids 18 to 72 (55 residues), 34.6 bits, see alignment 2.2e-12 PF00384: Molybdopterin" amino acids 75 to 486 (412 residues), 138.6 bits, see alignment E=4.1e-44 PF01568: Molydop_binding" amino acids 588 to 692 (105 residues), 72 bits, see alignment E=6.1e-24

Best Hits

KEGG orthology group: None (inferred from 83% identity to xau:Xaut_2325)

Predicted SEED Role

"Anaerobic dehydrogenases, typically selenocysteine-containing" in subsystem Anaerobic respiratory reductases

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (706 amino acids)

>GFF1751 Dimethyl sulfoxide reductase DmsA (Xanthobacter sp. DMC5)
MNVHAPTVSHTAHSPVATHPSVCPHDCPSVCALKVDVMADGRIGRVHGSKDQPYTAGVIC
AKVARYAERANHPDRLTHPLLRTGPKGSGQFTRISWDEALDRVAEGLLKAEREHGAESVW
PYYYAGTMGLVMRDGINRLTHVKRYSRFFSSICVNPAWSGYMAGAGRIAGVDPREMAASG
LITLWGTNAVSTQVNVMTHAIHARKRHGAKIAVVDVYRTPTMEQADIPLLIRPGTDGALA
CAVMHVLFRDGFADRAYMDQYARDAAALEAHVATRTPEWASALCGLPVAEIEAYARLVGT
TPASYFRIGYGFSRSRNGAVNMHSVASIPVVAGSWQHLGGGALHSMSGTYGWRKKMIEGL
DRLDPTVRALDQSRIGPILMGEEDALAGGGKVAALLIQNTNPVAVAPEQEKVKRGFARED
LFVAVHEQFMTDTARMADIVLPATMFTEHDDIYGAGGHPHIQIGTKLVEPPGECRTNHDV
ICALASRLGAEHPGFAMTARELIDWTLRESGRGPVEALEEARFMDVGQDFRAAHFLDGFG
HRDKRFHFAVDWANLSFPAPGKFGPVADMPALPDHWAVIEEADAEHPFRLVTAPARNFLN
SSFTETPTSQEREGAPSLLVHPEDAAALGVAEDDLVAVENPRGRVELRVRLFDGLRRGVV
VSEQIQPSGAHRGGRGINTLTGADPVAPVGGAAFHDNKVRVVKIEV