Protein Info for PS417_08900 in Pseudomonas simiae WCS417

Annotation: dihydrolipoamide succinyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01347: dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex
  • amino acids 3 to 407 (405 residues), 618.1 bits, E=4.1e-190
• PF00364: Biotin_lipoyl
  • amino acids 4 to 75 (72 residues), 57.1 bits, E=2e-19
• PF02817: E3_binding
  • amino acids 109 to 143 (35 residues), 59.2 bits, 5.5e-20
• PF00198: 2-oxoacid_dh
  • amino acids 177 to 406 (230 residues), 290.1 bits, E=1.8e-90

Best Hits

Swiss-Prot: 82% identical to ODO2_PSEAE: Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (sucB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00658, 2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC: 2.3.1.61] (inferred from 98% identity to pfs:PFLU1821)

MetaCyc: 60% identical to 2-oxoglutarate dehydrogenase E2 subunit (Escherichia coli K-12 substr. MG1655)
Dihydrolipoyllysine-residue succinyltransferase. [EC: 1.2.1.105, 2.3.1.61]

Predicted SEED Role

"Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61)" in subsystem TCA Cycle (EC 2.3.1.61)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• TCA cycle II (plants and fungi) (7/9 steps found)
• TCA cycle III (animals) (7/10 steps found)
• L-lysine degradation II (L-pipecolate pathway) (4/9 steps found)
• L-lysine degradation XI (1/5 steps found)
• L-tryptophan degradation III (eukaryotic) (6/15 steps found)
• L-tryptophan degradation XI (mammalian, via kynurenine) (7/23 steps found)
• superpathway of L-lysine degradation (17/43 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Lysine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.105 or 2.3.1.61

Sequence Analysis Tools

See A0A1N7UCV1 at UniProt or InterPro

Protein Sequence (408 amino acids)

>PS417_08900 dihydrolipoamide succinyltransferase (Pseudomonas simiae WCS417)
MAIEIKAPSFPESVADGTVATWHKKPGDAVKRDDLIVDIETDKVVLEVLAEADGVLGAIV
AEEGATVLSNQVLGSIEEGSAAAAAPAAAAAPAAASAPAAAPAAGGEDPIAAPAARQLAE
ENGINLASIKGTGKDGRVTKEDVVAAVEAKKNAPAAAPAKAAAPAAAAPVFAAGDRTEKR
VPMTRVRATVAKRLVEAQSNMAMLTTFNEVDMTEVMALRSKYKDLFEKSHNGVRLGFMSF
FVKAATEALKRFPAVNASIDGNDIVYHGYADIGVAVSSDRGLVVPVLRNAELMSLAEIEG
GIATFGKKARDGKLTIDEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNIIQRPMA
INGQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPARLLLDI