Protein Info for GFF175 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: TRAP-type C4-dicarboxylate transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 39 to 281 (243 residues), 229.1 bits, see alignment E=3.1e-72 PF03480: DctP" amino acids 40 to 317 (278 residues), 271.4 bits, see alignment E=4.7e-85

Best Hits

Swiss-Prot: 38% identical to DCTP_VEREI: Solute-binding protein Veis_3954 (Veis_3954) from Verminephrobacter eiseniae (strain EF01-2)

KEGG orthology group: None (inferred from 81% identity to pol:Bpro_5094)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>GFF175 TRAP-type C4-dicarboxylate transport system, periplasmic component (Hydrogenophaga sp. GW460-11-11-14-LB1)
VKIHRKHFLAAVAAASLLAFGAGPAFAQKVLKYTHYQPAGNDQPKHAAALAFKDHVEKAT
NGSLKVELYPAGQLGPAQQVMEGLRLGTVELAVVHDGGIPGVYKTFNIFGLPFLFNDHAH
AYAVLDGKFGQELAEDMRKRTGIRLMGYADNGIRHFTNNKRAIKTPEDMKGLKIRVQPSP
VFVKLVESLGASPTAIDWGELPAALAQGTADGQENGVTNIMAASLFQHQKHITLDGHVYS
LHAYMVSERFFNGLNATEKKAVTEGVDIAKKIHRDMTRAQDLSAKKVLTEKGMTVTELTP
AEIDRFRKVAQPPVRAYLEAEVSKEWTEKLLQAAAAK