Protein Info for GFF1749 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 transmembrane" amino acids 6 to 34 (29 residues), see Phobius details amino acids 46 to 73 (28 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details TIGR03717: integral membrane protein, YjbE family" amino acids 11 to 185 (175 residues), 213.2 bits, see alignment E=1.1e-67 PF03741: TerC" amino acids 14 to 183 (170 residues), 157.4 bits, see alignment E=1.7e-50

Best Hits

KEGG orthology group: None (inferred from 83% identity to xau:Xaut_2327)

Predicted SEED Role

"blr4120; hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (235 amino acids)

>GFF1749 hypothetical protein (Xanthobacter sp. DMC5)
MSLDSPVLWLALLQIIWINVLLSGDNAVVIALACRSLPEKVRRTGIILGAGVAVGLRIIF
TGIVATLLALPWLKLVGSLALMWIAVDLASPDEGGEEAIQSSDNLWKAVGTVAVADIVMS
LDNVVAVAAIADGNWFLLIFGLAISIPLIIAGSSLVMSLINRFPLLVWAGAALLGWVAGD
MLLGDVAIIERLGEETTHHLHRIVSAAGAALVVGLALALRWYKGRRAHAHDDIAA