Protein Info for GFF1746 in Sphingobium sp. HT1-2

Annotation: Efflux ABC transporter for glutathione/L-cysteine, essential for assembly of bd-type respiratory oxidases => CydD subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 115 to 145 (31 residues), see Phobius details amino acids 216 to 244 (29 residues), see Phobius details amino acids 251 to 270 (20 residues), see Phobius details PF00664: ABC_membrane" amino acids 121 to 238 (118 residues), 34.5 bits, see alignment E=1.8e-12 PF00005: ABC_tran" amino acids 326 to 462 (137 residues), 79.7 bits, see alignment E=3.4e-26

Best Hits

Predicted SEED Role

"Transport ATP-binding protein CydD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (504 amino acids)

>GFF1746 Efflux ABC transporter for glutathione/L-cysteine, essential for assembly of bd-type respiratory oxidases => CydD subunit (Sphingobium sp. HT1-2)
MGWVIDIIGAALFAAGLAQGVSALANGVAIGWLPPLLLLAGGLVRAAGLMLAHVQAIRSA
QRIVAARRSTLLPRLLGGRLARPLLAGENATLAIDHLAAIEAHGARFLPIRKAAALGPLL
VAAIVATASWVCAAIMLATLLPFAFGMVLAGTAARAAAERQLAALAELSGLFVDRLRALP
LIRHHGAQARISRQVAGAAQEVATRTGAVLRVAFLSGAVLEFFAALSVALVAVYCGFALL
GLLPFPAPEALDLRAALFALALAPEFYLPMRRLAAAYHDKQMGEAADKAIAAALPEAEAA
PHPASPLFEGLHLKDLRIGMGSEIGPVSLTLKPHDLIALTGPTGSGKTSMLAAIAGQIDP
ASGELSLVDPARIAWAAQRPLLLPGSLADNIALARPDADRAEIAQVAARVGLTPMLAARP
EGLDLAIDHQGAGLSGGERRRIGLARAILSERPVLLCDEPTADLDAESATDIIALLVALS
TERAILVATHDHRLTAAARMEVML