Protein Info for GFF1744 in Sphingobium sp. HT1-2

Annotation: Cytochrome d ubiquinol oxidase subunit II (EC 1.10.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 transmembrane" amino acids 12 to 41 (30 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 124 to 147 (24 residues), see Phobius details amino acids 166 to 192 (27 residues), see Phobius details amino acids 205 to 227 (23 residues), see Phobius details amino acids 267 to 286 (20 residues), see Phobius details amino acids 293 to 318 (26 residues), see Phobius details amino acids 338 to 362 (25 residues), see Phobius details TIGR00203: cytochrome d ubiquinol oxidase, subunit II" amino acids 5 to 377 (373 residues), 438.1 bits, see alignment E=1.6e-135 PF02322: Cyt_bd_oxida_II" amino acids 10 to 365 (356 residues), 331.3 bits, see alignment E=3.1e-103

Best Hits

Swiss-Prot: 49% identical to CYDB_ECO57: Cytochrome bd-I ubiquinol oxidase subunit 2 (cydB) from Escherichia coli O157:H7

KEGG orthology group: K00426, cytochrome bd-I oxidase subunit II [EC: 1.10.3.-] (inferred from 76% identity to swi:Swit_3735)

MetaCyc: 49% identical to cytochrome bd-I subunit 2 (Escherichia coli K-12 substr. MG1655)
RXN0-5266 [EC: 7.1.1.7]; 1.11.1.- [EC: 7.1.1.7]; 1.11.1.- [EC: 7.1.1.7]

Predicted SEED Role

"Cytochrome d ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (381 amino acids)

>GFF1744 Cytochrome d ubiquinol oxidase subunit II (EC 1.10.3.-) (Sphingobium sp. HT1-2)
MTIPLDYETLRVIWWLLLGVLLIGFALTDGFDLGSAALLPFAGRTDEERRMIINSVGATW
EGNQVWFILGGGAIFAAWPFVYAVSFSGFYLAMFLVLSALILRPVGFKYRSKKPDARWRA
GWDWALFVGGLVPALVFGVAVGNVLVGAPFRLDGDLRMFYEGSLLGLFTPFTLLTGLLSV
AMLVLHGAGWLSLKTEGPVLQRVRLYGQGAAILSILLFAIGGLFVAWSGMGYRVDGVIDP
NGPSNPHLGGAVAAAGAWLDNYAAHPWMLLAPILGFAGPVLALLGIRGRRDTLVFAGSSI
ANVGIISTVGLSMFPFILPSSIDPGSSLTAWNASSSHGTLFTMLICTVIFLPIVLAYTAW
AYKVMFGRVTDREIRLNPDFY